Kallikrein-6

UniProt : Q92876, UniProt ID: KLK6_HUMAN,

Kallikrein-6

Homo sapiens

MKKLMVVLSLIAAAWAEEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTA
AHCKKPNLQVFLGKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSE
LIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNM
LCAGDEKYGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKT
IQAK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Kallikrein-6 contains a PF00089 domain.

Kallikrein-6 is proteolytically cut by kallikrein 6 (S01.236) cleavage. LRQR-ESSQ.

Kallikrein-6 is proteolytically cut by () cleavage. EQNK-LVHG.

Kallikrein-6 is proteolytically cut by kallikrein 6 (S01.236) cleavage. LRQR-ESSQ.

Kallikrein-6 is proteolytically cut by () cleavage. EQNK-LVHG.

Kallikrein-6 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. LRQR-ESSQ.

Kallikrein-6 is proteolytically cut by () cleavage. AAWA-EEQN.

Kallikrein-6 is proteolytically cut by kallikrein 6 (S01.236) cleavage. LRQR-ESSQ.

Kallikrein-6 is proteolytically cut by () cleavage. EQNK-LVHG.

Kallikrein-6 is proteolytically cut by kallikrein hK6 (S01.236) cleavage. LRQR-ESSQ.

Kallikrein-6 is proteolytically cut by () cleavage. AAWA-EEQN.

Kallikrein-6 is proteolytically cut by kallikrein 6 (S01.236) cleavage. LRQR-ESSQ.