Pediocin (PedA)

UniProt : P29430, Q8RL96, UniProt ID: PPA1_PEDAC, Q8RL96_PEDAC,

Pediocin (PedA)

Pediococcus acidilactici

MKKIEKLTEKEMANIIGGKYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNH
KC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Pediocin (PedA) contains a PF01721 domain.

Pediocin (PedA) is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. IIGG-KYYG.