Potential SCP-like extracellular protein

UniProt : Q59ZX3, UniProt ID: Q59ZX3_CANAL,

Potential SCP-like extracellular protein

Candida albicans

MKITNTLLNAAALLAVTEAATITKFFTASTQTLFVTQTSQTVVATKSFVETIYSAPPKQL
TSKTQDSTSPTTSSVNSLTSSSATSYVETTTPAPSSSTLTTSTISSSTASEDSDATPTAD
VEFAEEILKEHNVKRALHGVPALSWSNKLAEYAQDYANTGFDCSNLNLKHSGGPYGENLA
AGYMGGISPVDAWYDEISMVDWNNVDFTESTGHFTQLVWRSTTQVGCAKMMCSTAWRQIT
VCEYLPRGNVIGLNVTSGHSYFVDNVLPPLK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Potential SCP-like extracellular protein contains a PF00188 domain.

Potential SCP-like extracellular protein is proteolytically cut by kexin (S08.070) cleavage. NVKR-ALHG.