Isoform Delta of Protachykinin-1

UniProt : P06767, UniProt ID: P06767-4,

Isoform Delta of Protachykinin-1

Rattus norvegicus

MKILVAVAVFFLVSTQLFAEEIGANDDLNYWSDWSDSDQIKEAMPEPFEHLLQRIARRPK
PQQFFGLMGKRDAGHGQISHKMAYERSAMQNYERRRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform Delta of Protachykinin-1 contains a PF02202 domain.

Isoform Delta of Protachykinin-1 contains a PF02202 domain.

Isoform Delta of Protachykinin-1 is proteolytically cut by dipeptidyl-peptidase II (S28.002) cleavage. --RP-KPQQ.

Isoform Delta of Protachykinin-1 is proteolytically cut by (S9F.001) cleavage. FFGL-MNH2--.

Isoform Delta of Protachykinin-1 is proteolytically cut by penicillolysin (M35.001) cleavage. RPKP-QQFF.

Isoform Delta of Protachykinin-1 is proteolytically cut by aminopeptidase P1 (M24.009) cleavage. ---R-PKPQ.

Isoform Delta of Protachykinin-1 is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. PQQF-FGLM.

Isoform Delta of Protachykinin-1 is proteolytically cut by endothelin-converting enzyme 1 (M13.002) cleavage. KPQQ-FFGL.

Isoform Delta of Protachykinin-1 is proteolytically cut by neprilysin (M13.001) cleavage. PQQF-FGLM.

Isoform Delta of Protachykinin-1 is proteolytically cut by neprilysin (M13.001) cleavage. KPQQ-FFGL.

Isoform Delta of Protachykinin-1 is proteolytically cut by (M9G.026) cleavage. KQQF-FGLM.

Isoform Delta of Protachykinin-1 is proteolytically cut by coccolysin (M04.007) cleavage. PQQF-FGLM.

Isoform Delta of Protachykinin-1 is proteolytically cut by coccolysin (M04.007) cleavage. KPQQ-FFGL.