Isoform Gamma of Protachykinin-1

UniProt : P20366, Q549V1, UniProt ID: P20366-3, Q549V1_HUMAN,

Isoform Gamma of Protachykinin-1

Homo sapiens

MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDAGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform Gamma of Protachykinin-1 contains a PF02202 domain.

Isoform Gamma of Protachykinin-1 contains a PF02202 domain.

Isoform Gamma of Protachykinin-1 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KPQQ-FFGL.

Isoform Gamma of Protachykinin-1 is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. QFFG-LMGK.