cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a)

UniProt : A8K9A0, P63241, UniProt ID: A8K9A0_HUMAN, IF5A1_HUMAN,

cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a)

Homo sapiens

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLG
KEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a) contains a PF01287 domain.

cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a) is proteolytically cut by caspase () cleavage. DDLD-FETG.

cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a) is proteolytically cut by caspase () cleavage. DDLD-FETG.

cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a) is proteolytically cut by caspase () cleavage. ETGD-AGAS.

cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. ETGD-AGAS.

cDNA FLJ76631, highly similar to Homo sapiens eukaryotic translation initiation factor 5A (EIF5A), mRNA (Eukaryotic translation initiation factor 5A, isoform CRA_a) is proteolytically cut by granzyme B, human-type (S01.010) cleavage. LDFE-TGDA.