Putative uncharacterized protein

UniProt : P20366, Q6FHM1, UniProt ID: Q6FHM1_HUMAN, TKN1_HUMAN,

Putative uncharacterized protein

Homo sapiens

MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF02202 domain.

Putative uncharacterized protein contains a PF02202 domain.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. KPQQ-FFGL.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. QFFG-LMGK.