CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase)

UniProt : A5PL27, P00450, UniProt ID: A5PL27_HUMAN, CERU_HUMAN,

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase)

Homo sapiens

MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP
DRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH
SHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH
SHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC
SEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS
SSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV
RFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYY
SAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYF
SGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR
QSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK
KVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA
INGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFP
GTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) contains a PF07731 domain.

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) contains a PF07732 domain.

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) contains a PF07732 domain.

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) contains a PF07732 domain.

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) contains a PF00394 domain.

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) is proteolytically cut by plasmin (S01.233) cleavage. PQSR-SVPP.

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) is proteolytically cut by plasmin (S01.233) cleavage. PQSR-SVPP.

CP protein (Ceruloplasmin (Ferroxidase), isoform CRA_a) (Ceruloplasmin) (Ferroxidase) is proteolytically cut by plasmin (S01.233) cleavage. PYLK-VFNP.