DSPP600

UniProt : Q6YBV4, UniProt ID: Q6YBV4_PIG,

DSPP600

Sus scrofa

MKIIIYFCIWAIAWAIPVPQIKPLERHAIDKSVNLNLLAKSKAPVQDELNANDTTKGSGI
PMHDHDIGRQQDTKDGYKGERNGSEWADVGGNSSSARPMLANKEENTEDPNGDAGQPEPY
GHDGLHGRGDSSPANGLRGQVSILDNTGTANGSHVNGVTDKNSKNEDVGNASQSENATVV
PEDRYQVAGSNNSIGHEDEINGNFCRNGGDVSETTPPGEGEINGNEETGVTSGGSGAGNR
EFAGLDNSDGSPSGNGADEEEDKGSGDDEGEETGNGERTADTSKGQENPSHGEEEAEEED
DDHSLGQNSISSEDEGPGHKEAAHATDGDNTSKSEEDSDNIPGESRSQRIEDTQKPNQRE
TKAVANGVTAISEPLAIGKSQDKGIEIAAPRSGNRSNITKEAGKVSEDRESKGQHGMIVG
KGSVKTQGEADIMQRPGPKSEPGNKPGPSKTHSDSNSEGYDSYEFDGKSMQGDDPNSSEE
SNGSDDANSEGDNNHSSRGDTSYNSDESDDNGNDSDSKEEAEEDNTSDANDSDSDGNGDN
GSDDSGKSGSSKAESESSQSSESSESDCSIWRFPGQRGRIRAIAASLCHSHHNTRSELRL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DSPP600 is proteolytically cut by kallikrein 4 (S01.251) cleavage..

DSPP600 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IPGE-SRSQ.

DSPP600 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. EPLA-IGKS.

DSPP600 is proteolytically cut by matrix metallopeptidase-20 (M10.019) cleavage. AAPR-SGNR.