Putative uncharacterized protein SPINK5

UniProt : A8MYE8, UniProt ID: A8MYE8_HUMAN,

Putative uncharacterized protein SPINK5

Homo sapiens

MKIATVSVLLPLALCLIQDAASKNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFI
NKCATCKMILEKEAKSQKRARHLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCG
TDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTREND
PVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCT
RESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQNLGKAEEKTKVKREIVKLCSQY
QNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEARARNKRESGKA
TSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGK
SRNKRQSKSTASFEELCSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMCEAFFQQE
ERARAKAKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEE
EEKKNDKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTC
SMCEAFFQQEAKEKERAEPRAKVKREAEKETCDEFRRLLQNGKLFCTRENDPVRGPDGKT
HGNKCAMCKAVFQKENEERKRKEEEDQRNAAGHGSSGGGGGNTQDECAEYREQMKNGRLS
CTRESDPVRDADGKSYNNQCTMCKAKLEREAERKNEYSRSRSNGTGSESGKDTCDEFRSQ
MKNGKLICTRESDPVRGPDGKTHGNKCTMCKEKLEREAAEKKKKEDEDRSNTGERSNTGE
RSNDKEDLCREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSIFDREANERKKKD
EEKSSSKPSNNAKDQCRQVQNEAEDAKFRQPGRSLASVARMSTDECSEFRNYIRNNELIC
PRENDPVHGADGKFYTNKCYMCRAVFLTEALERAKLQEKPSHVRASQEEDSPDSFSSLDS
EMCKDYRVLPRIGYLCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRSTGKCEESS
TPGTTAASMPPSDE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF00050 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 contains a PF07648 domain.

Putative uncharacterized protein SPINK5 is proteolytically cut by furin (S08.071) cleavage..

Putative uncharacterized protein SPINK5 is proteolytically cut by furin (S08.071) cleavage..

Putative uncharacterized protein SPINK5 is proteolytically cut by furin (S08.071) cleavage..