Serine protease inhibitor Kazal-type 5

UniProt : Q9NQ38, UniProt ID: ISK5_HUMAN,

Serine protease inhibitor Kazal-type 5

Homo sapiens

MKIATVSVLLPLALCLIQDAASKNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFI
NKCATCKMILEKEAKSQKRARHLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCG
TDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTREND
PVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCT
RESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQNLGKAEEKTKVKREIVKLCSQY
QNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEARARNKRESGKA
TSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGK
SRNKRQSKSTASFEELCSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMCEAFFQQE
ERARAKAKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEE
EEKKNDKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTC
SMCEAFFQQEAKEKERAEPRAKVKREAEKETCDEFRRLLQNGKLFCTRENDPVRGPDGKT
HGNKCAMCKAVFQKENEERKRKEEEDQRNAAGHGSSGGGGGNTQDECAEYREQMKNGRLS
CTRESDPVRDADGKSYNNQCTMCKAKLEREAERKNEYSRSRSNGTGSESGKDTCDEFRSQ
MKNGKLICTRESDPVRGPDGKTHGNKCTMCKEKLEREAAEKKKKEDEDRSNTGERSNTGE
RSNDKEDLCREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSIFDREANERKKKD
EEKSSSKPSNNAKDECSEFRNYIRNNELICPRENDPVHGADGKFYTNKCYMCRAVFLTEA
LERAKLQEKPSHVRASQEEDSPDSFSSLDSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQT
YNNPCMLCHENLIRQTNTHIRSTGKCEESSTPGTTAASMPPSDE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Serine protease inhibitor Kazal-type 5 contains a PF00050 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 contains a PF07648 domain.

Serine protease inhibitor Kazal-type 5 is proteolytically cut by furin (S08.071) cleavage..

Serine protease inhibitor Kazal-type 5 is proteolytically cut by furin (S08.071) cleavage..