cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a)

UniProt : B2RAI1, P05546, UniProt ID: B2RAI1_HUMAN, HEP2_HUMAN,

cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a)

Homo sapiens

MKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFH
KENTVTNDWIPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGK
SRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSI
LHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKV
REYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWV
NKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVP
HKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDK
NGNMAGISDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVRFTVDRPFLFLIY
EHRTSCLLFMGRVANPSRS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a) contains a PF00079 domain.

cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a) is proteolytically cut by neutrophil elastase (S01.131) cleavage. VTTV-GFMP.

cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a) is proteolytically cut by neutrophil elastase (S01.131) cleavage. LLPA-DFHK.

cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a) is proteolytically cut by neutrophil elastase (S01.131) cleavage. LEKI-FSED.

cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a) is proteolytically cut by cathepsin G (S01.133) cleavage. VTTV-GFMP.

cDNA, FLJ94926, highly similar to Homo sapiens serine (or cysteine) proteinase inhibitor, clade D(heparin cofactor), member 1 (SERPIND1), mRNA (Serpin peptidase inhibitor, clade D (Heparin cofactor), member 1, isoform CRA_a) is proteolytically cut by cathepsin G (S01.133) cleavage. LEKI-FSED.