Enterocin A (EntA protein) (Pre-peptide of enterocin A) (Enterocin A)

UniProt : Q47784, UniProt ID: Q47784_ENTFC,

Enterocin A (EntA protein) (Pre-peptide of enterocin A) (Enterocin A)

Enterococcus faecium

MKHLKILSIKETQLIYGGTTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGA
IPGKC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Enterocin A (EntA protein) (Pre-peptide of enterocin A) (Enterocin A) contains a PF01721 domain.

Enterocin A (EntA protein) (Pre-peptide of enterocin A) (Enterocin A) is proteolytically cut by bacteriocin-processing peptidase (C39.001) cleavage. IYGG-TTHS.