Putative uncharacterized protein (Related to cell cycle regulation and aging protein)

UniProt : Q7SH61, UniProt ID: Q7SH61_NEUCR,

Putative uncharacterized protein (Related to cell cycle regulation and aging protein)

Neurospora crassa

MKGVIGLALAAAVSGVVAQPHNHHGHHHAKKHAHAGIDKRADGTVVVTEVVQGPTVVEYV
LDGKKVDANEAEKGIKEGDYVVLGSSKPSFVAPPPVVSTSKASIPGGALFLELTSSMSTS
TSTSTSTSSSTTSSIPTTSSSPIPSSTSSEPPAATSSAASENLSGGGLDSEFPSGKIRCD
HFPSDYGALGVDWLNLSGWTTLAKVGKLMKGVAINNYEQPISGPCQPGMLCSYACPPGYQ
KTQWPEDSQGATGQSIGGLYCNNDGFLELTRASHPTLCEQGAGGVYVKNMLPKSAAICRT
DYPGNEAMVIPLETNPGGQYPLTNPVSSSYYKWKGQSTTAQYYVNNMGIPVDDACTWNSK
SCPDCAGNWAPVNVGVGKSDDGVTYISIFPNAPTTNAILNFDMEIQGDISGECWLKNGKY
SGSNGCTVGLSEGGTATVVLKPRGD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein (Related to cell cycle regulation and aging protein) contains a PF03856 domain.

Putative uncharacterized protein (Related to cell cycle regulation and aging protein) is proteolytically cut by kexin (S08.070) cleavage. IDKR-ADGT.