GM gelatinase

UniProt : A1E464, UniProt ID: A1E464_ENTFA,

GM gelatinase

Enterococcus faecalis

MKGNKILYILGTGIFVGSSCLFSSLFVAAEEQVYSESEVSTVLSKLEKEAISEAAAEQYT
VVDRKEDAWGMKHLKLEKQTEGVTVDSDNVIIHLDKNGAVTSVTGNPVDQVVKIQSVDAI
GEEGVKKIIASDNPETKDLVFLAIDKRVNNEGQLFYKFRVTSSLIGDPVSLVYKVNATDG
TIMEKQDLTEHVGSEVTLKNSFQVTFNVPVEKSNTGIALHGTDNTGVYHAVVDGKNNYSI
IQAPSLATLNQNAVDAYTHGKFVKTYYEDHFQRHSIDDRGMPILSVVDEQHPDAYDNAFW
DGKAMRYGETSTPTGKTYASSLDVVGHEMTHGVTEHTAGLEYLGQSGALNESYSDLMGYI
ISGASNPEIGADTQSVDRKTGIRNLQTPSKHGQPETMAQYDDRARYKGTPYYDQGGVHYN
SGIINRIGYTIIQNLGIEKAQTIFYSSLVNYLTPKAQFSDARDAMLAAAKVQYGDEAASV
VSAAFNSAGIGAKEDIQVNQPSESVLVNE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

GM gelatinase contains a PF07504 domain.

GM gelatinase contains a PF03413 domain.

GM gelatinase contains a PF02868 domain.

GM gelatinase contains a PF01447 domain.

GM gelatinase is proteolytically cut by coccolysin (M04.007) cleavage. AKED-IQVN.