Putative uncharacterized protein

UniProt : A4RF06, UniProt ID: A4RF06_MAGGR,

Putative uncharacterized protein

Magnaporthe grisea

MKGLAHLTLAATLIAGVAEAQHANHHRHLHAKRDVAKRSPEVVVKYEQGPTETTYVIDGK
TISADEAKAGLADGRYLVVGESEPVFSPPPPPAPKSTTQAAIFVEQKPTSSSSSSEAPKP
TSTAPPSSNTSTPTGLDAPFPNGTIPCSSLPTEYGARPLDWLGIGGWASIMQPDEKKWTP
GTMIATLHQTVSGGCTPNCFCSYACPNGYQKTQWPETSQGATGQSIGGLWCNAEGFLELT
RPEVKTLCTAGAGGVFVQNNLPGTVAVCQTDYPGNEQMSIPLETLPGQKYTLTNPDAKKS
YFWKGSPTSGQFYVNPLNVPVEDACVWTSPTNPDSAGNWAPVNMGVGKDVHGITYLSIFP
NLPTSHAQLDFDIEITGDITAPCALKGGSYTGGGNGCTTAISKPGGQATIVFSKGS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF03856 domain.

Putative uncharacterized protein is proteolytically cut by kexin (S08.070) cleavage. VAKR-SPEV.