Apolipoprotein J (Fragment)

UniProt : Q8IWM0, UniProt ID: Q8IWM0_HUMAN,

Apolipoprotein J (Fragment)

Homo sapiens

CSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRL
ANLTQGEDQYYLRVTT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Apolipoprotein J (Fragment) contains a PF01093 domain.

Apolipoprotein J (Fragment) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..