GABARAP protein (HCG1987397, isoform CRA_b) (GABA(A) receptor-associated protein)

UniProt : O95166, Q6IAW1, UniProt ID: GBRAP_HUMAN, Q6IAW1_HUMAN,

GABARAP protein (HCG1987397, isoform CRA_b) (GABA(A) receptor-associated protein)

Homo sapiens

MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

GABARAP protein (HCG1987397, isoform CRA_b) (GABA(A) receptor-associated protein) contains a PF02991 domain.

GABARAP protein (HCG1987397, isoform CRA_b) (GABA(A) receptor-associated protein) is proteolytically cut by ATG4 peptidase (C54.003) cleavage. SVYG-L---.

GABARAP protein (HCG1987397, isoform CRA_b) (GABA(A) receptor-associated protein) is proteolytically cut by ATG4 peptidase (C54.003) cleavage. SVYG-L---.

GABARAP protein (HCG1987397, isoform CRA_b) (GABA(A) receptor-associated protein) is proteolytically cut by autophagin-1 (C54.003) cleavage. SVYG-L.