Potential cell wall protein

UniProt : Q59Q33, UniProt ID: Q59Q33_CANAL,

Potential cell wall protein

Candida albicans

MKFSTVALSLPLIAMVQAGISSPTYYKPEHTEEIGVETVDYEFALGVREKCDEDTIYLAY
EVDDGQLERNDKKVDCNCKSEPVVYPTPRPSKTYWDGGDDNDECDEDCDDEDKKKGHKQY
KRGEVEEPCETSDCDFCTIEKSFCQDQFTLCEGVLKDQRSAIGSIVANHQFQFDNPIQKD
ALHTCGWSIVEKDCVKLLALDGCTDFWECPVDDCDTYKLYDSSIDDKCKEIEIIVILFEE
EEEEKKKHKSW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Potential cell wall protein is proteolytically cut by kexin (S08.070) cleavage. QYKR-GEVE.