Potential cell wall protein
UniProt : Q59Q33, UniProt ID: Q59Q33_CANAL, Potential cell wall protein Candida albicans MKFSTVALSLPLIAMVQAGISSPTYYKPEHTEEIGVETVDYEFALGVREKCDEDTIYLAY EVDDGQLERNDKKVDCNCKSEPVVYPTPRPSKTYWDGGDDNDECDEDCDDEDKKKGHKQY KRGEVEEPCETSDCDFCTIEKSFCQDQFTLCEGVLKDQRSAIGSIVANHQFQFDNPIQKD ALHTCGWSIVEKDCVKLLALDGCTDFWECPVDDCDTYKLYDSSIDDKCKEIEIIVILFEE EEEEKKKHKSW The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Potential cell wall protein is proteolytically cut by kexin (S08.070) cleavage. QYKR-GEVE.