Putative uncharacterized protein

UniProt : P35454, Q545V4, UniProt ID: NEU1_MOUSE, Q545V4_MOUSE,

Putative uncharacterized protein

Mus musculus

MACPSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDMRKCLPCGPGGKGRCFGPSICCA
DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPES
AFSER

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00184 domain.

Putative uncharacterized protein contains a PF00220 domain.

Putative uncharacterized protein is proteolytically cut by cystinyl aminopeptidase (M01.011) cleavage. ---C-YIQN.