Putative uncharacterized protein CIS303
UniProt : Q59TE9, UniProt ID: Q59TE9_CANAL, Putative uncharacterized protein CIS303 Candida albicans MKFSTVALSLPLIAMVQAGISSPTYYKPEHNEEHGVETVEFEFALGVREKCDDSIIYLVY EVDDGQLERNDKKLDCNCKSERVSRPAPSPSAIAVVGGNEECDEDCDDEHRKKGSKQYKR GEVENPRETRDCDFCTIEKSFCQDHFTLCEGVLKDQHSAIGSIVSNHQFQFDKPAQKDAL HTCGWSIVEKDCVKLLAVDGCTDFWECPVDDCDTYKLYNSAIDAKCKEIEIIVILLEEEE ERKHKSW The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Putative uncharacterized protein CIS303 is proteolytically cut by kexin (S08.070) cleavage. RVSR-PAPS.
Putative uncharacterized protein CIS303 is proteolytically cut by kexin (S08.070) cleavage. QYKR-GEVE.
Putative uncharacterized protein CIS303 is proteolytically cut by kexin (S08.070) cleavage. RETR-DCDF.