Putative uncharacterized protein CIS303

UniProt : Q59TE9, UniProt ID: Q59TE9_CANAL,

Putative uncharacterized protein CIS303

Candida albicans

MKFSTVALSLPLIAMVQAGISSPTYYKPEHNEEHGVETVEFEFALGVREKCDDSIIYLVY
EVDDGQLERNDKKLDCNCKSERVSRPAPSPSAIAVVGGNEECDEDCDDEHRKKGSKQYKR
GEVENPRETRDCDFCTIEKSFCQDHFTLCEGVLKDQHSAIGSIVSNHQFQFDKPAQKDAL
HTCGWSIVEKDCVKLLAVDGCTDFWECPVDDCDTYKLYNSAIDAKCKEIEIIVILLEEEE
ERKHKSW

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein CIS303 is proteolytically cut by kexin (S08.070) cleavage. RVSR-PAPS.

Putative uncharacterized protein CIS303 is proteolytically cut by kexin (S08.070) cleavage. QYKR-GEVE.

Putative uncharacterized protein CIS303 is proteolytically cut by kexin (S08.070) cleavage. RETR-DCDF.