YALI0E33539p

UniProt : Q6C3M7, UniProt ID: Q6C3M7_YARLI,

YALI0E33539p

Yarrowia lipolytica

MKFSTLALAAMAAIGFAAPATPDADCNEEKEVRDFHAHHQHKRAVQVEYVYVTVLVDGNG
NTIEQQQIATTELQEAPSPAPATSTQEAAPAPSSTLVAAFAAKEPVTQEASSAASSAAPS
STSAPKSSSAPSKPSNGGSGGITGDLAAFSGPSEKFQDGTIDCGDFPSGQGVIALNQLGF
GGWSGIYHPGSTATGGNCAEGAYCSYACQSGMSKTQWPDEQPANGVSVGGLLCKGGKLYR
SNQQSDYLCEWGTQSAIVTSSLDKEVAICRTDYPGTENMVIPTVVEAGSSGVPLAVVNQD
AYYTWMGKPTSAQYYVNNAGVSYQDGCLWGTSSGDVGNWAPLNFGAGAAGGISYLSIIPN
PNNRNSANFNVEIIATNGATVNGKCVYENGKYNGGDSNGCTVAVTGGVAAFHLY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

YALI0E33539p contains a PF03856 domain.

YALI0E33539p is proteolytically cut by kexin (S08.070) cleavage. KEVR-DFHA.

YALI0E33539p is proteolytically cut by kexin (S08.070) cleavage. QHKR-AVQV.