YALI0D20680p

UniProt : Q6C8C9, UniProt ID: Q6C8C9_YARLI,

YALI0D20680p

Yarrowia lipolytica

MKFSTALLALAAVATAQPIVGHHAHHQHKREAGIETVFVQVTNYVDANGNAVDANGNPVQ
VATQAPQAPSPTAQVEAKVTAAAAAPAQEQKEGGSFAAWWSNMWEPAGQSTSAAAPKSSP
SATQKQEEAAAAPSSSSEAPKSSASSSSSSSSGSQGVPQSDSSFPGGALGMVYSPYNSDG
TCKDAGAVKSDLAKLSNYEVIRIYGTDCNQVPNVLAAIAPHQKIFAGVFDVNDVDNSLKA
ISDAVKAHGGWDVVHTVSIGNELVNNGAMTASAMNQITNSSRQKLRNYGYQGPVVSVDTF
IAVINNPELCDASDYMAVNAHAFFDGHIKAEDAGEWAVQQTQRVWTACNGKKEVMIAESG
WPSSGGTNGVAVPSKDNQNKAIQSLKSAIGNDCILFTAFNDYWKSPGAFAAEQYWGIFSN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

YALI0D20680p contains a PF00332 domain.

YALI0D20680p is proteolytically cut by kexin (S08.070) cleavage. QHKR-EAGI.