KLLA0B09746p

UniProt : Q6CVS7, UniProt ID: Q6CVS7_KLULA,

KLLA0B09746p

Kluyveromyces lactis

MKFSSVASTALLAASVHAGCDYVDGNYYCSETNAVVYSNVGYSGHYSDVTSMDESTCVCS
QSSVSFSGSLAPLNEELSVHFRGPINLVQFGVYYPGDSVSFKKRDQVAEDAPCTTVSTAK
KHHEHKREAAVQWVEVTSTIVVDGDGNPIETDATSGGSATEVTDGTTILTPVSSPVTSSP
ASAVSSSSSSASGSGSSSSTSSSSSSSSGSSSESSSAWNRVSYFTPGSAQNLTFMNHQGG
VKGSGTWSACFGNSISYCDSDGVTGAASAVALDDVTLPSNKEFMIFSGSSCDDSSEGDCG
YYRSDIPAYHGFGGAIKMFVFEFSMPTDNSGDYNVDMPAVWLLNAKIPRTLQYGDESCSC
WKTGCGELDLFEILSTGSDKLITHIHSGQGADSTSSGGGGTQDYFKRPTSGTLKAAVIFD
GADQTIHIVEVDDSFGSTISADTVNSWFSESGSSAAL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

KLLA0B09746p is proteolytically cut by kexin (S08.070) cleavage. FKKR-DQVA.

KLLA0B09746p is proteolytically cut by kexin (S08.070) cleavage. EHKR-EAAV.