Opaque-phase-specific protein OP4

UniProt : P46596, UniProt ID: OPS4_CANAL,

Opaque-phase-specific protein OP4

Candida albicans

MKFSQATILAIFASSALVSAAPANIVSEQTMVKREDVNAIVELINEIKHINQKRDLAEGE
DLLELQRRADSVIGELVSALYNSGVIGLVWDKLTTVPSISDSLSNIIKSAIQGAIVQGGA
LIQAVWNSGLLGDVFNKLINDTDLRQALLDVGKALFNSAANLISIWLGGSSSSSSAAPAA
AAAPATNGASKREIMEAAEYLSERDLASILSWIVQTIKDTGIVQSLVNQVINNPDTVISF
LTSALKNGLVIVEDLYDWAKQSGLWDQALVYIQNNAGSWIKALAGLFGNALSNGTITASD
INNAGSSSKPTGTTTASTATAAPKAATPAAASAAAPKAATSGSSSGSSSNNADLNALINK
YGGGSGSTSTPTVDTSGLSSDVNTLVNAAGQAASSLKKRKLY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Opaque-phase-specific protein OP4 is proteolytically cut by kexin (S08.070) cleavage. MVKR-EDVN.

Opaque-phase-specific protein OP4 is proteolytically cut by kexin (S08.070) cleavage. NQKR-DLAE.

Opaque-phase-specific protein OP4 is proteolytically cut by kexin (S08.070) cleavage. LQRR-ADSV.

Opaque-phase-specific protein OP4 is proteolytically cut by kexin (S08.070) cleavage. ASKR-EIME.