Putative uncharacterized protein CIS312

UniProt : Q59TY6, UniProt ID: Q59TY6_CANAL,

Putative uncharacterized protein CIS312

Candida albicans

MKFSLATATLGLIAIAQATLTPYSGYSGYSGGDDDKYRHGKSGIETLRGKFALAVKELSG
YEHGKHKDRDLHIVYEIDDGQLQYGDRKDYIYYPYRNENSEEECSDEDDDHHKKKKRPHR
HGGKSDDDDDDKKWKRGGDYSDDNDNDSDDDLRFLTISYNDKYDFFTLKNTVLHDEKGAT
GEIVANHQFQFDKPPQKDALYDKGFTIVEKDDYYVLALKGKTKFWNSAVDDKGAFKIYDE
KINENSKPIELIILKVEKHGKKY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein CIS312 is proteolytically cut by kexin (S08.070) cleavage. KKKR-PHRH.

Putative uncharacterized protein CIS312 is proteolytically cut by kexin (S08.070) cleavage. KWKR-GGDY.