Protein PRY2

UniProt : P36110, UniProt ID: PRY2_YEAST,

Protein PRY2

Saccharomyces cerevisiae

MKFSKVSLLAASASVALSAPVAVTVTQHVHQAATVVVQGIVRVENGQTLTTFITKGTQTA
SASPVATTSAPIVVANAQVDSIATSVIQESAVVAESATFEESSTETSEAFSTATATIQAV
QTSASATQDDVTTTLTSSTQPTSTTTPTTTTTSPTTTTSPTTTASPTTTASPTTATTTQS
TASSTQSSSSDFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSG
GPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCG
GEWGDYIICSYKAAGNVIGEFADNVMPLA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein PRY2 contains a PF00188 domain.

Protein PRY2 is proteolytically cut by kexin (S08.070) cleavage. NTKR-ALHK.