ECE1

UniProt : B2B9R2, UniProt ID: B2B9R2_CANAL,

ECE1

Candida albicans

MKFSKIACATVFALSSQAAIIHHAPEFNMKRDVAPAAPAAPADQAPTVPAPQEFNTAITK
RSIIGIIMGILGNIPQVIQIIMSIVKAFKGNKREDIDSVVAGIIADMPFVVRAVDTAMTS
VASTKRDGANDDVANAVVRLPEIVARVATGVQQSVENAKRDGVPDIGLNLVANAPRLFSD
VFDGVSETVQQAKRDGLEDVLQQLLDQLPQLIARSAESALKDSQPVKRDAGSVALSNLIK
KSIETVGIENAAQIVSERDISSLIEEYFGNA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

ECE1 is proteolytically cut by kexin (S08.070) cleavage. NMKR-DVAP.

ECE1 is proteolytically cut by kexin (S08.070) cleavage. ITKR-SIIG.

ECE1 is proteolytically cut by kexin (S08.070) cleavage. GNKR-EDID.

ECE1 is proteolytically cut by kexin (S08.070) cleavage. STKR-DGAN.

ECE1 is proteolytically cut by kexin (S08.070) cleavage. NAKR-DGVP.

ECE1 is proteolytically cut by kexin (S08.070) cleavage. QAKR-DGLE.

ECE1 is proteolytically cut by kexin (S08.070) cleavage. PVKR-DAGS.