Gamma-aminobutyric acid receptor-associated protein-like 1

UniProt : Q9H0R8, UniProt ID: GBRL1_HUMAN,

Gamma-aminobutyric acid receptor-associated protein-like 1

Homo sapiens

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gamma-aminobutyric acid receptor-associated protein-like 1 contains a PF02991 domain.

Gamma-aminobutyric acid receptor-associated protein-like 1 is proteolytically cut by ATG4 peptidase (C54.003) cleavage. SVYG-K---.