SUN domain protein (Uth1), putative

UniProt : Q4WGL5, UniProt ID: Q4WGL5_ASPFU,

SUN domain protein (Uth1), putative

Aspergillus fumigatus

MKFNTVALTLATAGSLVTAQHHHQHRHHQHKREDVVESSATVVQYELDGKPISLKQVCAG
LADNTLKFANNDHPTGICDNLSSAAAPASTPEVTSAFAPAQFIELSSVVTSATPTSASSS
ETVQTPAASSSSASSSSTATGLDADFPDGELDCSTFPSEYGAIPLDYLKLGGWSGIQYVS
YAGNFINDIVTAVAGDTCKDGAMCSYACPPGYQKSQWPSTQGATGQSVGGIECRNGKLHL
TNPSLSKKLCIPGVGGVHVQNTLGETVAVCRTDYPGTESETIPIGLGGNDLQPLTCPDGE
TYYKWQGKTTSAQYYVNPKGVTPEKGCQWGDGTQPIGNWAPVNLGVGLNKGKWLSIFQNS
PTTSEKLDFNIKIKGDNLSGSCKYENGVFYSETGSSSSGCTVQVMSGDATFVFY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

SUN domain protein (Uth1), putative contains a PF03856 domain.

SUN domain protein (Uth1), putative is proteolytically cut by kexin (S08.070) cleavage. QHKR-EDVV.