Melittin

UniProt : P01501, UniProt ID: MEL_APIME,

Melittin

Apis mellifera

MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALI
SWIKRKRQQG

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Melittin contains a PF01372 domain.

Melittin is proteolytically cut by hyicolysin (M30.001) cleavage. WIKR-KRQQ.

Melittin is proteolytically cut by hyicolysin (M30.001) cleavage. PALI-SWIK.

Melittin is proteolytically cut by hyicolysin (M30.001) cleavage. ALIS-WIKR.

Melittin is proteolytically cut by hyicolysin (M30.001) cleavage. LPAL-ISWI.

Melittin is proteolytically cut by hyicolysin (M30.001) cleavage. GLPA-LISW.

Melittin is proteolytically cut by hyicolysin (M30.001) cleavage. AVLK-VLTT.

Melittin is proteolytically cut by hyicolysin (M30.001) cleavage. GIGA-VLKV.

Melittin is proteolytically cut by gingipain K (C25.002) cleavage. AVLK-VLTT.

Melittin is proteolytically cut by cathepsin E (A01.010) cleavage. TTGL-PALI.

Melittin is proteolytically cut by cathepsin E (A01.010) cleavage. GAVL-KVLT.