Mating factor alpha-2

UniProt : P32435, UniProt ID: MFAL2_YEAST,

Mating factor alpha-2

Saccharomyces cerevisiae

MKFISTFLTFILAAVSVTASSDEDIAQVPAEAIIGYLDFGGDHDIAFLPFSNATASGLLF
INTTIAEAAEKEQNTTLAKREAVADAWHWLNLRPGQPMYKREANADAWHWLQLKPGQPMY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Mating factor alpha-2 contains a PF04648 domain.

Mating factor alpha-2 contains a PF04648 domain.

Mating factor alpha-2 contains a PF05436 domain.

Mating factor alpha-2 is proteolytically cut by kexin (S08.070) cleavage. MYKR-EANA.