cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1)

UniProt : B2R5E8, P09382, UniProt ID: B2R5E8_HUMAN, LEG1_HUMAN,

cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1)

Homo sapiens

MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1) contains a PF00337 domain.

cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPGE-CLRV.

cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IKCV-AFD-.

cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. KPGE-CLRV.

cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. IKCV-AFD-.

cDNA, FLJ92447, Homo sapiens lectin, galactoside-binding, soluble, 1 (galectin 1)(LGALS1), mRNA (Lectin, galactoside-binding, soluble, 1) (Galectin 1) is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..