Cholecystokinin
|
Cholecystokinin Rattus norvegicus MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Cholecystokinin contains a PF00918 domain.
Cholecystokinin is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. RQLR-AVLR.
Cholecystokinin is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. ISDR-DYMG.