Isoform C of Decorin

UniProt : P07585, UniProt ID: P07585-3,

Isoform C of Decorin

Homo sapiens

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLAN
TPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGV
SLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin contains a PF01462 domain.

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin contains a PF00560 domain.

Isoform C of Decorin is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DAAS-LKGL.

Isoform C of Decorin is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DAAS-LKGL.

Isoform C of Decorin is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DAAS-LKGL.