Isoform D of Decorin

UniProt : P07585, UniProt ID: P07585-4,

Isoform D of Decorin

Homo sapiens

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHVVYLHNNNISVV
GSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin contains a PF01462 domain.

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin contains a PF00560 domain.

Isoform D of Decorin is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. DTTL-LDLQ.

Isoform D of Decorin is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. GLDK-VPKD.