PMAP: SubstrateDB : DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238)

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238)

UniProt : P07585, Q6FH10, UniProt ID: PGS2_HUMAN, Q6FH10_HUMAN,

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238)

Homo sapiens

MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE
LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS
LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF00560 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) contains a PF01462 domain.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. GLDK-VPKD.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. DTTL-LDLQ.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LNQM-IVIE.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NPLK-SSGI.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. GLDK-VPKD.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. DTTL-LDLQ.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LNQM-IVIE.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NPLK-SSGI.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LREL-HLDN.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LEDE-ASGI.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. MLED-EASG.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. GLDK-VPKD.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. DTTL-LDLQ.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LNQM-IVIE.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NPLK-SSGI.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LREL-HLDN.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LEDE-ASGI.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. MLED-EASG.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by procollagen C-peptidase (M12.005) cleavage. FMLE-DEAS.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. GLDK-VPKD.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. DTTL-LDLQ.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LNQM-IVIE.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NPLK-SSGI.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LREL-HLDN.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. LEDE-ASGI.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. MLED-EASG.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by procollagen C-peptidase (M12.005) cleavage. FMLE-DEAS.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DAAS-LKGL.

DCN protein (Decorin, isoform CRA_b) (cDNA FLJ75936, highly similar to Homo sapiens decorin (DCN), transcript variant A1, mRNA) (Putative uncharacterized protein DKFZp686J19238) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. DAAS-LKGL.