C-C motif chemokine 7

UniProt : P80098, UniProt ID: CCL7_HUMAN,

C-C motif chemokine 7

Homo sapiens

MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCP
REAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

C-C motif chemokine 7 contains a PF00048 domain.

C-C motif chemokine 7 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPVG-INTS.

C-C motif chemokine 7 is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. QPVG-INTS.

C-C motif chemokine 7 is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. QPVG-INTS.

C-C motif chemokine 7 is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. QPVG-INTS.

C-C motif chemokine 7 is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QPVG-INTS.

C-C motif chemokine 7 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. QPVG-INTS.