Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c)

UniProt : A1L467, UniProt ID: A1L467_HUMAN,

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c)

Homo sapiens

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) contains a PF01833 domain.

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) contains a PF01437 domain.

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) contains a PF01403 domain.

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) contains a PF01833 domain.

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) contains a PF07714 domain.

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) contains a PF01833 domain.

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) is proteolytically cut by furin (S08.071) cleavage. RKKR-STKK.

Met proto-oncogene (Hepatocyte growth factor receptor) (Met proto-oncogene (Hepatocyte growth factor receptor), isoform CRA_c) is proteolytically cut by () cleavage..