cDNA, FLJ93290, Homo sapiens coagulation factor II (thrombin) receptor-like 2 (F2RL2), mRNA (Coagulation factor II (Thrombin) receptor-like 2)

UniProt : B2R754, O00254, UniProt ID: B2R754_HUMAN, PAR3_HUMAN,

cDNA, FLJ93290, Homo sapiens coagulation factor II (thrombin) receptor-like 2 (F2RL2), mRNA (Coagulation factor II (Thrombin) receptor-like 2)

Homo sapiens

MKALIFAAAGLLLLLPTFCQSGMENDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWT
GATITVKIKCPEESASHLHVKNATMGYLTSSLSTKLIPAIYLLVFVVGVPANAVTLWMLF
FRTRSICTTVFYTNLAIADFLFCVTLPFKIAYHLNGNNWVFGEVLCRATTVIFYGNMYCS
ILLLACISINRYLAIVHPFTYRGLPKHTYALVTCGLVWATVFLYMLPFFILKQEYYLVQP
DITTCHDVHNTCESSSPFQLYYFISLAFFGFLIPFVLIIYCYAAIIRTLNAYDHRWLWYV
KASLLILVIFTICFAPSNIILIIHHANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFL
MSKTRNHSTAYLTK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ93290, Homo sapiens coagulation factor II (thrombin) receptor-like 2 (F2RL2), mRNA (Coagulation factor II (Thrombin) receptor-like 2) contains a PF00001 domain.

cDNA, FLJ93290, Homo sapiens coagulation factor II (thrombin) receptor-like 2 (F2RL2), mRNA (Coagulation factor II (Thrombin) receptor-like 2) is proteolytically cut by gingipain K (C25.002) cleavage..

cDNA, FLJ93290, Homo sapiens coagulation factor II (thrombin) receptor-like 2 (F2RL2), mRNA (Coagulation factor II (Thrombin) receptor-like 2) is proteolytically cut by gingipain K (C25.002) cleavage..

cDNA, FLJ93290, Homo sapiens coagulation factor II (thrombin) receptor-like 2 (F2RL2), mRNA (Coagulation factor II (Thrombin) receptor-like 2) is proteolytically cut by thrombin (S01.217) cleavage. LPIK-TFRG.