Putative uncharacterized protein

UniProt : A8K866, P02647, UniProt ID: A8K866_HUMAN, APOA1_HUMAN,

Putative uncharacterized protein

Homo sapiens

MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF01442 domain.

Putative uncharacterized protein is proteolytically cut by () cleavage. HAKA-TEHL.

Putative uncharacterized protein is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RLAE-YHAK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LRAE-LQEG.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ALED-LRQG.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HLST-LSEK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. KVEP-LRAE.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LESF-KVSF.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. ALED-LRQG.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. ATEH-LSTL.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RLAE-YHAK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. KVEP-LRAE.

Putative uncharacterized protein is proteolytically cut by Transthyretin () cleavage. LESF-KVSF.

Putative uncharacterized protein is proteolytically cut by () cleavage. HAKA-TEHL.

Putative uncharacterized protein is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RLAE-YHAK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. LRAE-LQEG.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. ALED-LRQG.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HLST-LSEK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. KVEP-LRAE.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. LESF-KVSF.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. ALED-LRQG.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. ATEH-LSTL.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RLAE-YHAK.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. KVEP-LRAE.

Putative uncharacterized protein is proteolytically cut by Transthyretin () cleavage. LESF-KVSF.

Putative uncharacterized protein is proteolytically cut by chymase (S01.140) cleavage. ATVY-VDVL.

Putative uncharacterized protein is proteolytically cut by chymase (S01.140) cleavage. VSQF-EGSA.

Putative uncharacterized protein is proteolytically cut by chymase (S01.140) cleavage. LESF-KVSF.