Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a)

UniProt : P10646, Q53TS4, UniProt ID: Q53TS4_HUMAN, TFPI1_HUMAN,

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a)

Homo sapiens

MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADD
GPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQE
KPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPN
GFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIG
KCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
VKNM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) contains a PF00014 domain.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) contains a PF00014 domain.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) contains a PF00014 domain.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. TPQS-TKVP.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. NANR-IIKT.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. PPLK-LMHS.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PPLK-LMHS.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by neutrophil elastase (S01.131) cleavage. IIKT-TLQQ.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. PPLK-LMHS.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. TPQS-TKVP.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. PPLK-LMHS.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. PPLK-LMHS.

Putative uncharacterized protein TFPI (Tissue factor pathway inhibitor (Lipoprotein-associated coagulation inhibitor), isoform CRA_a) is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. PPLK-LMHS.