Caspase-activated DNase

UniProt : Q9NDR2, UniProt ID: Q9NDR2_DROME,

Caspase-activated DNase

Drosophila melanogaster

MISYIRDAIMSPTTRSSSNNKKSNQPTGEVLKDVSSSESRGTAGAPMRGYKVTDNERTRK
YGIGANSLEMLIAKAKSKFPLLELHLYLASDGFEVSDDEYLKSLPAQTLFIVSGPDAVIT
TDADFEFEKMRQQSPLLKVADIFYDFIEQHPEKFRRMITEYEHQKQRRVLDNSKTHLSLK
AEHVEWFTGGEERFHSKEEAMATRAQTRVRGYYYKAKEELTRNPLYRQNAKARQVINSVL
EKFRYLLIGCDFFSMMFDRNCKQKHEFLKQHLGDEETDAGRIPSKRLRQVIREYTKENCI
LDEWSTSLCSDLGDFYCQGSYSENGNSCSKQHTINPYASRENLILFQVWNLDHQIELCRT
ILPALVANVEELVSHPQTKCSIHKKQVVDISVLEYFLEIFSLKNLKLVHIVCHEKAQRSN
RSNGRLLCSDCHEYRIVQELMEVQVDSLAT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Caspase-activated DNase contains a PF02017 domain.

Caspase-activated DNase contains a PF09230 domain.

Caspase-activated DNase is proteolytically cut by caspase-3 (C14.003) cleavage..