cDNA, FLJ92485, Homo sapiens elastase 2A (ELA2A), mRNA (Elastase 2A) (cDNA FLJ32116 fis, clone PANCR1000081, highly similar to Elastase-2A)

UniProt : B2R5I4, P08217, UniProt ID: B2R5I4_HUMAN, ELA2A_HUMAN,

cDNA, FLJ92485, Homo sapiens elastase 2A (ELA2A), mRNA (Elastase 2A) (cDNA FLJ32116 fis, clone PANCR1000081, highly similar to Elastase-2A)

Homo sapiens

MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGG
SLIANSWVLTAAHCISSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLV
VDYATCSSSAWWGSSVKTSMICAGGDGVISSCNGDSGGPLNCQASDGRWQVHGIVSFGSR
LGCNYYHKPSVFTRVSNYIDWINSVIANN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92485, Homo sapiens elastase 2A (ELA2A), mRNA (Elastase 2A) (cDNA FLJ32116 fis, clone PANCR1000081, highly similar to Elastase-2A) contains a PF00089 domain.

cDNA, FLJ92485, Homo sapiens elastase 2A (ELA2A), mRNA (Elastase 2A) (cDNA FLJ32116 fis, clone PANCR1000081, highly similar to Elastase-2A) is proteolytically cut by trypsin 1 (S01.151) cleavage. YVTR-VVGG.