Isoform 1 of Collagen alpha-1(II) chain

UniProt : P02458, UniProt ID: P02458-1,

Isoform 1 of Collagen alpha-1(II) chain

Homo sapiens

MIRLGAPQTLVLLTLLVAAVLRCQGQDVRQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAG
EQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDE
KAGGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPG
KPGDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKG
ESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPG
APGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAG
APGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEG
KRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPG
RPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKG
ANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPG
PPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDG
PKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTG
PIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKG
EQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPG
SNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEG
PPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTG
PAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRG
EAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGPSG
DQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGPPG
PPGPPGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESI
RSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPA
NVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNI
TYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTV
IEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01410 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF00093 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain contains a PF01391 domain.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. PGAA-GRVG.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. PPGP-SGKD.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. PGPS-GKDG.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. GAAG-VKGD.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. SPGP-AGPT.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. PGAA-GRVG.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. PPGP-SGKD.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. PGPS-GKDG.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. GAAG-VKGD.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by ADAMTS5 peptidase (M12.225) cleavage. SPGP-AGPT.

Isoform 1 of Collagen alpha-1(II) chain is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QMGV-MQGV.