Homo sapiens

MIRLGAPQSLVLLTLLVAAVLRCQGQDVRQPGPKGQKGEPGDIKDIVGPKGPPGPQGPAG
EQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDE
KAGGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMGPRGPPGPPG
KPGDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKGEAGAPGVKG
ESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVGPAGGPGFPG
APGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKGSAGAPGIAG
APGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQGAPGPAGEEG
KRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAGPKGANGDPG
RPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPGVMGFPGPKG
ANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPGPSGFQGLPG
PPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRGLPGTPGTDG
PKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPGKDGGRGLTG
PIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKG
EQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPG
SNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPGDDGPSGAEG
PPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTG
PAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAGPTGKQGDRG
EAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGPSG
DQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGPPG
PPGPPGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESI
RSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPA
NVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNI
TYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTV
IEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPSG-FQGL.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-ARGQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPRG-ERGF.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GARG-LTGR.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPSG-LAGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAPG-LRGL.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-ANGD.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-ERGA.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GPQG-LAGQ.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GQRG-IVGL.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GLAG-QRGI.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-ARGF.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-FQGN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPRG-LPGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-AAGA.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAAG-ARGN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPEG-AQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-ASGN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-QTGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-EEGK.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAQG-LQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPRG-LPGT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-LQGM.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-ANGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-FAGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPTG-VTGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-ATGF.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-ARGD.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-LAGQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GQRG-IVGL.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-LTGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GARG-IQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GHRG-FTGL.