cDNA FLJ76908, highly similar to Homo sapiens D4, zinc and double PHD fingers family 2 (DPF2), mRNA (D4, zinc and double PHD fingers family 2, isoform CRA_a)

UniProt : A8K7C9, Q92785, UniProt ID: A8K7C9_HUMAN, REQU_HUMAN,

cDNA FLJ76908, highly similar to Homo sapiens D4, zinc and double PHD fingers family 2 (DPF2), mRNA (D4, zinc and double PHD fingers family 2, isoform CRA_a)

Homo sapiens

MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKR
HRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLE
ALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRR
GKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGED
KEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPS
MSEPPEGSWSCHLCLDLLKEKASIYQNQNSS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76908, highly similar to Homo sapiens D4, zinc and double PHD fingers family 2 (DPF2), mRNA (D4, zinc and double PHD fingers family 2, isoform CRA_a) contains a PF00096 domain.

cDNA FLJ76908, highly similar to Homo sapiens D4, zinc and double PHD fingers family 2 (DPF2), mRNA (D4, zinc and double PHD fingers family 2, isoform CRA_a) contains a PF00628 domain.

cDNA FLJ76908, highly similar to Homo sapiens D4, zinc and double PHD fingers family 2 (DPF2), mRNA (D4, zinc and double PHD fingers family 2, isoform CRA_a) contains a PF00628 domain.

cDNA FLJ76908, highly similar to Homo sapiens D4, zinc and double PHD fingers family 2 (DPF2), mRNA (D4, zinc and double PHD fingers family 2, isoform CRA_a) is proteolytically cut by caspase () cleavage. ISQD-GSSL.

cDNA FLJ76908, highly similar to Homo sapiens D4, zinc and double PHD fingers family 2 (DPF2), mRNA (D4, zinc and double PHD fingers family 2, isoform CRA_a) is proteolytically cut by caspase () cleavage. DKED-SQPP.