Homo sapiens

MIRLGAPQSLVLLTLLVAAVLRCQGQDVQEAGSCVQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDVKDCLSPEIPFGECCPICPTDLATASGQPGPKGQKGEPGDIKDIVGPKG
PPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFA
AQMAGGFDEKAGGAQLGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPPGKPGDDGEAGKPGKAGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQG
APGPAGEEGKRGARGEPGGVGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRG
LPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGEPGLQGPAGPPGEKGEPG
DDGPSGAEGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGAPGPPGSPGPAG
PTGKQGDRGEAGAQGPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAG
PPGNPGPPGPPGPPGPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLK
SLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTK
HTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GPPG-SNGN.

is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GRVG-PPGS.

is proteolytically cut by procollagen C-peptidase (M12.005) cleavage. YMRA-DQAA.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. CPTD-LATA.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. EPGD-IKDI.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. DIKD-IVGP.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. EPGD-IKDI.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. DIKD-IVGP.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. NFAA-QMAG.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. FAAQ-MAGG.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. FAAQ-MAGG.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. NFAA-QMAG.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. NFAA-QMAG.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. FAAQ-MAGG.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. FAAQ-MAGG.

is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. GGAQ-LGVM.

is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. AQLG-VMQG.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. QLGV-MQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. QLGV-MQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. LGVM-QGPM.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. AGGA-QLGV.

is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. QLGV-MQGP.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GPQG-LAGQ.

is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GLAG-QRGI.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-ARGF.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPRG-LPGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-AAGA.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAAG-ARGN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPEG-AQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-ASGN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-QTGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-ERGA.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GQDG-LAGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-ANGD.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GARG-LTGR.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-ARGQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAPG-LRGL.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPSG-FQGL.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPRG-ERGF.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GAQG-LQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPRG-LPGT.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-LQGM.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-ANGE.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-FQGN.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPAG-FAGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPTG-VTGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-ATGF.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPKG-ARGD.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPQG-LAGQ.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GQRG-IVGL.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GPPG-LTGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GARG-IQGP.

is proteolytically cut by matrix metallopeptidase-9 (M10.004) cleavage. GHRG-FTGL.