YIL015W homolog (Strain CBS138 chromosome J complete sequence)

UniProt : Q76IP5, UniProt ID: Q76IP5_CANGA,

YIL015W homolog (Strain CBS138 chromosome J complete sequence)

Candida glabrata

MIQFINCYFIFNLVTVVNCLRLTIEKRIVSSHASLSKRSAVDLQFRRFNNLYYESVLEFG
TPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLIDCSGLVFYDMDKSQTFDYLK
NVTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPAMESVN
GYEFAPGKFYPNFPLALKNAGFTNIAAYSIEYNDESKKGSILFGSIDTSRFIGPLYTFPM
INEFPGIADEPSTLSLTLDGIGIDGSCEQWVISNTKLPALLDTGSTLIELPHPITQSIAS
YLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFILLPDEESNGLCGLGI
TSSKGRVILGDSFLTHVYTVFDLDNYMISLAPMAKSSLPGKVIEIPANGLIENAVISKSE
KWTHFNDITVNEYGFRNYCDGELQDIHSYSSKLNSSSLVYSSNFSSDEEQNSSESVSPSI
FNTDSSIKEIYPSLSQKEHLSALLTTISTSEIHKPVTATITDSITTTIRVTKILTVLQCA
T

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

YIL015W homolog (Strain CBS138 chromosome J complete sequence) contains a PF00026 domain.

YIL015W homolog (Strain CBS138 chromosome J complete sequence) is proteolytically cut by kexin (S08.070) cleavage. LSKR-SAVD.

YIL015W homolog (Strain CBS138 chromosome J complete sequence) is proteolytically cut by kexin (S08.070) cleavage. QFRR-FNNL.