Brevican core protein

UniProt : P55068, UniProt ID: PGCB_RAT,

Brevican core protein

Rattus norvegicus

MIPLLLSLLAALVLTQAPAALADDLKEDSSEDRAFRVRIGAAQLRGVLGGALAIPCHVHH
LRPPPSRRAAPGFPRVKWTFLSGDREVEVLVARGLRVKVNEAYRFRVALPAYPASLTDVS
LVLSELRPNDSGVYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACAR
IGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQNPREACYGDMDGYPGVRNYGVVG
PDDLYDVYCYAEDLNGELFLGAPPGKLTWEEARDYCLERGAQIASTGQLYAAWNGGLDRC
SPGWLADGSVRYPIITPSQRCGGGLPGVKTLFLFPNQTGFPSKQNRFNVYCFRDSAHPSA
FSEASSPASDGLEAIVTVTEKLEELQLPQEAVESESRGAIYSIPITEDGGGGSSTPEDPA
EAPRTPLESETQSVAPPTGSSEEEGEALEEEERFKDTETPKEEKEQENLWVWPTELSSPL
PTGLETEHSLSQVSPPAQAVLQVGASPSPRPPRVHGPTVETLQPPGEGSLTSTPDGAREV
GGETGSPELSGVPREREEAGSSSLEDGPSLLPETWAPVGTREVETPSEEKSGRTVLTGTS
VQAQPVLPTDSASRGGVAVAPSSGDCIPSPCHNGGTCLEEKEGFRCLCVPGYGGDLCDVG
LHFCSPGWEPFQGACYKHFSTRRSWEEAESQCRALGAHLTSICTPEEQDFVNDRYREYQW
IGLNDRTIEGDFLWSDGPPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHL
SYTCKMGLVSCGPPPQLPLAQIFGRPRLRYAVDTVLRYRCRDGLAQRNLPLIRCQENGLW
EAPQISCVPRRPARALRSMTAPEGPRGQLPRQRKALLTPPSSL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Brevican core protein contains a PF00008 domain.

Brevican core protein contains a PF00059 domain.

Brevican core protein contains a PF00193 domain.

Brevican core protein contains a PF00193 domain.

Brevican core protein contains a PF00084 domain.

Brevican core protein contains a PF00047 domain.

Brevican core protein is proteolytically cut by ADAMTS4 peptidase (M12.221) cleavage. VESE-SRGA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. HPSA-FSEA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. HPSA-FSEA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. HPSA-FSEA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. HPSA-FSEA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. HPSA-FSEA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-10 (M10.006) cleavage. HPSA-FSEA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. HPSA-FSEA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. KLEE-LQLP.

Brevican core protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. SRGA-IYSI.

Brevican core protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. TPSE-EKSG.

Brevican core protein is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. LTGT-SVQA.

Brevican core protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. PPAQ-AVLQ.

Brevican core protein is proteolytically cut by matrix metallopeptidase-10 (M10.006) cleavage. PPAQ-AVLQ.

Brevican core protein is proteolytically cut by matrix metallopeptidase-7 (M10.008) cleavage. AVLQ-VGAS.

Brevican core protein is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. PTVE-TLQP.

Brevican core protein is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. APVG-TREV.